PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004556
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 747aa    MW: 82298.3 Da    PI: 6.8606
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58695111PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.2e-202479156
               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++ +++t+ q+++Le+ F+ +++p++++r +L+++lgL  rq+k+WFqNrR+++k
  Lsa004556 24 KKRYHRHTALQIQILESTFKDCPHPDEKTRMQLSRELGLAPRQIKFWFQNRRTQMK 79
               688899***********************************************998 PP

2START157.78.9e-502384662206
                HHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
      START   2 laeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                +a  a +el+k+++ +ep+W+k        e +n d + + f++s+         ++ea++asgvv m++ +lv  ++d+  +W e ++    +a t+e+
  Lsa004556 238 IASNAIDELMKLVQTNEPLWTKCQkdgmhtEVLNLDNYKRVFPRSNDhnlkspnVRIEASKASGVVMMNSLQLVDMFVDST-KWMELFPtivsRARTIEA 336
                577899******************7666665556666666666555599****99**************************.9*999999999******* PP

                ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX CS
      START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlp 177
                ++        g lqlm+ elq+lsplv+ R f+++R+ +q ++g+w++v vS d +q++   +s  +a++lpSg+li++ +ng+skvtwveh+++++ +p
  Lsa004556 337 LEARllgslsGSLQLMYEELQVLSPLVStRQFYVLRFVQQIEQGSWAVVNVSYDLPQHNAYPHSRCKAHRLPSGCLIQDIPNGYSKVTWVEHMEVEEISP 436
                ***********************************************************98888899********************************* PP

                .HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
      START 178 .hwllrslvksglaegaktwvatlqrqcek 206
                 + l+r lv+sgla+ga++w+a+lqr ce+
  Lsa004556 437 tDRLYRDLVHSGLAFGARRWLACLQRACER 466
                99**************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-201684IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-211985IPR009057Homeodomain-like
PROSITE profilePS5007117.3622181IPR001356Homeobox domain
SMARTSM003895.3E-192285IPR001356Homeobox domain
CDDcd000866.25E-192482No hitNo description
PfamPF000462.3E-172479IPR001356Homeobox domain
PROSITE patternPS0002705679IPR017970Homeobox, conserved site
PROSITE profilePS5084849.989228469IPR002913START domain
SuperFamilySSF559613.59E-38229466No hitNo description
CDDcd088751.91E-106232465No hitNo description
SMARTSM002342.5E-37237466IPR002913START domain
Gene3DG3DSA:3.30.530.201.4E-11238464IPR023393START-like domain
PfamPF018522.2E-43239466IPR002913START domain
SuperFamilySSF559615.13E-23489665No hitNo description
SuperFamilySSF559615.13E-23698737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MEYGAGGEGD GSASGSHHDS SDKKKRYHRH TALQIQILES TFKDCPHPDE KTRMQLSREL  60
GLAPRQIKFW FQNRRTQMKA QHERADNCAL RAENDKIRCE NIVIREALKN LVCPTCGGPP  120
IGEDCYFDEQ KLRFENAQLK EELDRVSSIA AKYIGRPMLQ LPPVQPVHMS SLDLSMASSY  180
GGGPVNRMVM MNSGPSLDLD LLTGSAIGAS SSNIVNPDPP FHNIVHLSDM DKSLMADIAS  240
NAIDELMKLV QTNEPLWTKC QKDGMHTEVL NLDNYKRVFP RSNDHNLKSP NVRIEASKAS  300
GVVMMNSLQL VDMFVDSTKW MELFPTIVSR ARTIEALEAR LLGSLSGSLQ LMYEELQVLS  360
PLVSTRQFYV LRFVQQIEQG SWAVVNVSYD LPQHNAYPHS RCKAHRLPSG CLIQDIPNGY  420
SKVTWVEHME VEEISPTDRL YRDLVHSGLA FGARRWLACL QRACERSASL MMASTSSHDI  480
GGVIPSAPGK RSMMKLSQRM VRNLCSGINP SNGHQWTSVS GLNDQFEVRA TLYKTTDPAG  540
HPNGMVLSAS TTIWLPVPPQ NVFDFFRDGR TRPQWDVLSN QNPVQEVAHI ANGTHPGNCI  600
SVLRAYTPSQ NNMLILQESC TDASGSLVVY CPVDLPAINI AMNGEDPSYI PLLPSGFIIT  660
TDGRHEITSQ GQGGASTSSN NNSDLGAADH CGGGTSTGSL VTVVFQIQVS SLPSAKMSPE  720
SLTTVNNLIT NTVHQIKASF NYASTTT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072039.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A068TTE00.0A0A068TTE0_COFCA; Uncharacterized protein
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11